PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G40290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 242aa    MW: 26084.8 Da    PI: 5.4034
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G40290.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM54.54e-1781391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      l pG+ F+P+d+ l++ +L++k+++ ++e  + i+++d+y+++P +L  ++      ++  s+  k++a+g+r++ +  +++Wk+ g +k+v  
  OGLUM03G40290.1   8 LEPGYAFRPSDDGLITLFLRPKIAKIPFEH-RLINHTDVYSADPAELVGEH-RPAPGTHGSSSVCKRKASGRRQRAVGGESVWKSEGGKKAVNG 99 
                      579************************999.89**************7332.223466777777777778888888889*************** PP

              NAM  95 kkgelvglkktLvfy......kgrapkgektdWvmheyrl 128
                      ++g+ vg  + + +       +g+a++ ++  W+m ey l
  OGLUM03G40290.1 100 ADGRRVGYLQKFSYGvyesssSGSARTFTRLGWCMTEYGL 139
                      ********99999966677766889999999*******76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-286158IPR003441NAC domain
PROSITE profilePS5100525.9348158IPR003441NAC domain
PfamPF023655.9E-910138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MDDDEIALEP GYAFRPSDDG LITLFLRPKI AKIPFEHRLI NHTDVYSADP AELVGEHRPA  60
PGTHGSSSVC KRKASGRRQR AVGGESVWKS EGGKKAVNGA DGRRVGYLQK FSYGVYESSS  120
SGSARTFTRL GWCMTEYGLD DDATDGADKH VLCKVYRSPR AVCAEARTAA AKCSGYKRKA  180
DDGEDHPEAA PPSARPRQEE AGSEHDEQPE LDLDALLSAP TDENLESTFS TAATAVALAL  240
VV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629679.11e-145PREDICTED: NAC transcription factor NAM-2-like
TrEMBLA0A0D9ZFL51e-179A0A0D9ZFL5_9ORYZ; Uncharacterized protein
STRINGORGLA03G0372600.11e-143(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43632158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.24e-13NAC family protein